1.68 Rating by CuteStat

newmexicorisperdallawsuit.com is 1 decade 6 months old. It is a domain having com extension. It has a global traffic rank of #9708365 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, newmexicorisperdallawsuit.com is SAFE to browse.

PageSpeed Score
87
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 50
Daily Pageviews: 100

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 9,708,365
Domain Authority: 1 ON 100

Web Server Information

Hosted IP Address:

69.56.136.51

Hosted Country:

United States of America US

Location Latitude:

32.7831

Location Longitude:

-96.8067

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.56.136.51)

Risperdal Tardive Dyskinesia Lawyer

- risperdaltardivedyskinesialawyer.com
Not Applicable $ 8.95

Don't worry! Checked out our essay samples to enjoy some enthusiasm fo

- medicalnewsnetwork.info

Don't worry! Checked out our essay samples to enjoy some enthusiasm for producing your management essay or research paper! Term paper examples are likewise

Not Applicable $ 8.95

Opti-Free Replenish Class Action Lawsuit | Lawyer, Law Firm

- optifreereplenishclassactionlawsuit.com

Learn more about filing an Opti-Free Replenish lawsuit if you or a loved one suffered from side effects caused by Opti-Free Replenish eye contact solution.

Not Applicable $ 8.95

Jack Sparrow

- jacksparrow.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 17 Nov 2013 23:29:03 GMT
Server: Apache
X-Pingback: http://www.newmexicorisperdallawsuit.com/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: DropCatch.com 1435 LLC
Registration Date: Oct 29, 2013, 12:00 AM 1 decade 6 months 1 week ago
Last Modified: Oct 29, 2013, 12:00 AM 1 decade 6 months 1 week ago
Expiration Date: Oct 29, 2014, 12:00 AM 9 years 6 months 2 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
sns247.websitewelcome.com 65.75.177.217 United States of America United States of America
sns248.websitewelcome.com 65.75.128.242 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
newmexicorisperdallawsuit.com A 14390 IP: 69.56.136.51
newmexicorisperdallawsuit.com NS 86400 Target: sns248.websitewelcome.com
newmexicorisperdallawsuit.com NS 86400 Target: sns247.websitewelcome.com
newmexicorisperdallawsuit.com SOA 86400 MNAME: sns247.websitewelcome.com
RNAME: root.sawgrass.websitewelcome.com
Serial: 2013110102
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
newmexicorisperdallawsuit.com MX 14400 Target: newmexicorisperdallawsuit.com
newmexicorisperdallawsuit.com TXT 14400 TXT: v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites

Sven Ullrich -

- ullrich.es
9,708,367 $ 240.00

myGloss - a beauty & lifestyle blog

- mygloss.ch

Auf myGloss.ch schreiben sieben Bloggerinnen über ihre Lieblingsthemen Beauty, Food, Fitness und Travel. Lass Dich inspirieren!

9,708,373 $ 240.00

Home Page - secretairfares.com

- secretairfares.ca
9,708,383 $ 240.00

mytorr.site - Registered at Namecheap.com

- mytorr.site
9,708,390 $ 240.00

Insmopt | We're Hiring !!

- insmopt.com
9,708,399 $ 8.95

Full WHOIS Lookup

Domain Name: NEWMEXICORISPERDALLAWSUIT.COM
Creation Date: 2013-10-29 17:27:00Z
Registrar Registration Expiration Date: 2014-10-29 17:27:00Z
Registrar: ENOM, INC.
Reseller: NAMECHEAP.COM
Registrant Name: WHOISGUARD PROTECTED
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code: NA
Registrant Country: PA
Admin Name: WHOISGUARD PROTECTED
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code: NA
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 353A702C20CE447C93D672CE8C3D653B.PROTECT@WHOISGUARD.COM
Tech Name: WHOISGUARD PROTECTED
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code: NA
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 353A702C20CE447C93D672CE8C3D653B.PROTECT@WHOISGUARD.COM
Name Server: SNS247.WEBSITEWELCOME.COM
Name Server: SNS248.WEBSITEWELCOME.COM

The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002